PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000740.1_g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 342aa    MW: 38725.2 Da    PI: 6.7731
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000740.1_g00023.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-5261331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtd+el+ +yLk+k+eg ++el evi+ vd+yk++Pw+Lp k  + +++ ew+fF++rdkky++g+r+nratksgyWk
  Itr_sc000740.1_g00023.1   6 LPPGFRFHPTDDELIGYYLKRKTEGLEIEL-EVIPVVDLYKFDPWELPeKsFLPNRDMEWFFFCPRDKKYPNGSRTNRATKSGYWK 90 
                              79****************************.99**************95334556888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v++ k ++vg +ktLvfy+grap g ++dWvmheyr+
  Itr_sc000740.1_g00023.1  91 ATGKDRKVVC-KPSTVGYRKTLVFYRGRAPLGDRSDWVMHEYRI 133
                              **********.8889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-614156IPR003441NAC domain
PROSITE profilePS5100558.276156IPR003441NAC domain
PfamPF023653.6E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRGASLPPGF RFHPTDDELI GYYLKRKTEG LEIELEVIPV VDLYKFDPWE LPEKSFLPNR  60
DMEWFFFCPR DKKYPNGSRT NRATKSGYWK ATGKDRKVVC KPSTVGYRKT LVFYRGRAPL  120
GDRSDWVMHE YRISDYDSQG NPIFQGQFVL CRVIKRNDVS LKTINARGET SEKVRCNSSN  180
GDISSVPDEP IVISGNIPTQ TTCKTTESNC SIPVPSSPYK TSQLGDYEFH VHPSSSSLLI  240
SPDMILNSSK DYRHQGQHTF GYYPQYGFAN STLWQPYENP ELSSSSSYSS IRAEVELSDD  300
LTRYGCMSAY SAQGSYIGFY GGEDASGQGY DQSILLTNPN LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-51516216171NO APICAL MERISTEM PROTEIN
1ut4_B1e-51516216171NO APICAL MERISTEM PROTEIN
1ut7_A1e-51516216171NO APICAL MERISTEM PROTEIN
1ut7_B1e-51516216171NO APICAL MERISTEM PROTEIN
4dul_A1e-51516216171NAC domain-containing protein 19
4dul_B1e-51516216171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016575709.11e-161PREDICTED: NAC domain-containing protein 45-like
TrEMBLQ8LRL41e-157Q8LRL4_PETHY; Nam-like protein 11
STRINGSolyc08g077110.2.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.15e-98NAC domain containing protein 71